Lineage for d1p4qa1 (1p4q A:9-52)

  1. Root: SCOPe 2.08
  2. 3045664Class j: Peptides [58231] (151 folds)
  3. 3047306Fold j.96: Transactivation domain [81275] (1 superfamily)
  4. 3047307Superfamily j.96.1: Transactivation domain [74800] (1 family) (S)
  5. 3047308Family j.96.1.1: Transactivation domain [74801] (2 proteins)
  6. 3047315Protein Cbp/p300-interacting transactivator 2, Cited2 [90295] (1 species)
  7. 3047316Species Human (Homo sapiens) [TaxId:9606] [90296] (2 PDB entries)
  8. 3047318Domain d1p4qa1: 1p4q A:9-52 [87777]
    Other proteins in same PDB: d1p4qa2, d1p4qb_
    complexed with TAZ1 domain of mouse CBP
    complexed with zn

Details for d1p4qa1

PDB Entry: 1p4q (more details)

PDB Description: solution structure of the cited2 transactivation domain in complex with the p300 ch1 domain
PDB Compounds: (A:) Cbp/p300-interacting transactivator 2

SCOPe Domain Sequences for d1p4qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p4qa1 j.96.1.1 (A:9-52) Cbp/p300-interacting transactivator 2, Cited2 {Human (Homo sapiens) [TaxId: 9606]}
nvidtdfideevlmslviemgldrikelpelwlgqnefdfmtdf

SCOPe Domain Coordinates for d1p4qa1:

Click to download the PDB-style file with coordinates for d1p4qa1.
(The format of our PDB-style files is described here.)

Timeline for d1p4qa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1p4qa2
View in 3D
Domains from other chains:
(mouse over for more information)
d1p4qb_