| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest |
Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (3 families) ![]() |
| Family c.59.1.1: MurCDEF C-terminal domain [53245] (4 proteins) |
| Protein UDP-N-acetylmuramate-alanine ligase MurC [82452] (2 species) |
| Species Haemophilus influenzae [TaxId:727] [89727] (4 PDB entries) |
| Domain d1p3db2: 1p3d B:322-473 [87732] Other proteins in same PDB: d1p3da1, d1p3da3, d1p3db1, d1p3db3 complexed with anp, mn, uma |
PDB Entry: 1p3d (more details), 1.7 Å
SCOPe Domain Sequences for d1p3db2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p3db2 c.59.1.1 (B:322-473) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]}
gagrrfdqlgefirpngkvrlvddyghhptevgvtikaaregwgdkrivmifqphrysrt
rdlfddfvqvlsqvdalimldvyaageapivgadskslcrsirnlgkvdpilvsdtsqlg
dvldqiiqdgdlilaqgagsvskisrglaesw
Timeline for d1p3db2: