PDB entry 1p3d

View 1p3d on RCSB PDB site
Description: Crystal Structure of UDP-N-acetylmuramic acid:L-alanine ligase (MurC) in Complex with UMA and ANP.
Class: ligase
Keywords: alpha/beta protein, LIGASE
Deposited on 2003-04-17, released 2003-07-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.17
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UDP-N-acetylmuramate--alanine ligase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: murC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45066
      • modified residue (14)
      • modified residue (30)
      • modified residue (109)
      • modified residue (114)
      • modified residue (134)
      • modified residue (137)
      • modified residue (186)
      • modified residue (193)
      • modified residue (198)
      • modified residue (208)
      • modified residue (227)
      • modified residue (235)
      • modified residue (370)
      • modified residue (399)
    Domains in SCOPe 2.06: d1p3da1, d1p3da2, d1p3da3
  • Chain 'B':
    Compound: UDP-N-acetylmuramate--alanine ligase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: murC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45066
      • modified residue (14)
      • modified residue (30)
      • modified residue (109)
      • modified residue (114)
      • modified residue (134)
      • modified residue (137)
      • modified residue (186)
      • modified residue (193)
      • modified residue (198)
      • modified residue (208)
      • modified residue (227)
      • modified residue (235)
      • modified residue (370)
      • modified residue (399)
    Domains in SCOPe 2.06: d1p3db1, d1p3db2, d1p3db3
  • Heterogens: MN, UMA, ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1p3dA (A:)
    mkhsheeirkiipemrrvqqihfigiggagmsgiaeillnegyqisgsdiadgvvtqrla
    qagakiyighaeehiegasvvvvssaikddnpelvtskqkripviqraqmlaeimrfrhg
    iavagthgkttttamismiytqakldptfvngglvksagknahlgasryliaeadesdas
    flhlqpmvsvvtnmepdhmdtyegdfekmkatyvkflhnlpfyglavmcaddpvlmelvp
    kvgrqvitygfseqadyriedyeqtgfqghytvicpnnerinvllnvpgkhnalnataal
    avakeegianeailealadfqgagrrfdqlgefirpngkvrlvddyghhptevgvtikaa
    regwgdkrivmifqphrysrtrdlfddfvqvlsqvdalimldvyaageapivgadskslc
    rsirnlgkvdpilvsdtsqlgdvldqiiqdgdlilaqgagsvskisrglaeswkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p3dA (A:)
    iipemrrvqqihfigiggagmsgiaeillnegyqisgsdiadgvvtqrlaqagakiyigh
    aeehiegasvvvvssaikddnpelvtskqkripviqraqmlaeimrfrhgiavagthgkt
    tttamismiytqakldptfvngglvksagknahlgasryliaeadesdasflhlqpmvsv
    vtnmepdhmdtyegdfekmkatyvkflhnlpfyglavmcaddpvlmelvpkvgrqvityg
    fseqadyriedyeqtgfqghytvicpnnerinvllnvpgkhnalnataalavakeegian
    eailealadfqgagrrfdqlgefirpngkvrlvddyghhptevgvtikaaregwgdkriv
    mifqphrysrtrdlfddfvqvlsqvdalimldvyaageapivgadskslcrsirnlgkvd
    pilvsdtsqlgdvldqiiqdgdlilaqgagsvskisrglaesw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1p3dB (B:)
    mkhsheeirkiipemrrvqqihfigiggagmsgiaeillnegyqisgsdiadgvvtqrla
    qagakiyighaeehiegasvvvvssaikddnpelvtskqkripviqraqmlaeimrfrhg
    iavagthgkttttamismiytqakldptfvngglvksagknahlgasryliaeadesdas
    flhlqpmvsvvtnmepdhmdtyegdfekmkatyvkflhnlpfyglavmcaddpvlmelvp
    kvgrqvitygfseqadyriedyeqtgfqghytvicpnnerinvllnvpgkhnalnataal
    avakeegianeailealadfqgagrrfdqlgefirpngkvrlvddyghhptevgvtikaa
    regwgdkrivmifqphrysrtrdlfddfvqvlsqvdalimldvyaageapivgadskslc
    rsirnlgkvdpilvsdtsqlgdvldqiiqdgdlilaqgagsvskisrglaeswkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1p3dB (B:)
    emrrvqqihfigiggagmsgiaeillnegyqisgsdiadgvvtqrlaqagakiyighaee
    hiegasvvvvssaikddnpelvtskqkripviqraqmlaeimrfrhgiavagthgktttt
    amismiytqakldptfvngglvksagknahlgasryliaeadesdasflhlqpmvsvvtn
    mepdhmdtyegdfekmkatyvkflhnlpfyglavmcaddpvlmelvpkvgrqvitygfse
    qadyriedyeqtgfqghytvicpnnerinvllnvpgkhnalnataalavakeegianeai
    lealadfqgagrrfdqlgefirpngkvrlvddyghhptevgvtikaaregwgdkrivmif
    qphrysrtrdlfddfvqvlsqvdalimldvyaageapivgadskslcrsirnlgkvdpil
    vsdtsqlgdvldqiiqdgdlilaqgagsvskisrglaesw