![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
![]() | Superfamily c.72.2: MurD-like peptide ligases, catalytic domain [53623] (3 families) ![]() has extra strand located between strands 1 and 2 |
![]() | Family c.72.2.1: MurCDEF [53624] (5 proteins) automatically mapped to Pfam PF08245 |
![]() | Protein UDP-N-acetylmuramate-alanine ligase MurC [82520] (2 species) |
![]() | Species Haemophilus influenzae [TaxId:727] [89776] (4 PDB entries) |
![]() | Domain d1p3db3: 1p3d B:107-321 [87733] Other proteins in same PDB: d1p3da1, d1p3da2, d1p3db1, d1p3db2 complexed with anp, mn, uma |
PDB Entry: 1p3d (more details), 1.7 Å
SCOPe Domain Sequences for d1p3db3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p3db3 c.72.2.1 (B:107-321) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} raqmlaeimrfrhgiavagthgkttttamismiytqakldptfvngglvksagknahlga sryliaeadesdasflhlqpmvsvvtnmepdhmdtyegdfekmkatyvkflhnlpfygla vmcaddpvlmelvpkvgrqvitygfseqadyriedyeqtgfqghytvicpnnerinvlln vpgkhnalnataalavakeegianeailealadfq
Timeline for d1p3db3: