SCOP 1.67: Domain d1p0yc1: 1p0y C:311-487

Lineage for d1p0yc1 (1p0y C:311-487)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.166: RuBisCo LSMT C-terminal, substrate-binding domain [81821] (1 superfamily)
   multihelical; irregular array of long and short helices

4. Superfamily a.166.1: RuBisCo LSMT C-terminal, substrate-binding domain [81822] (1 family)

5. Family a.166.1.1: RuBisCo LSMT C-terminal, substrate-binding domain [81823] (1 protein)

6. Protein RuBisCo LSMT C-terminal, substrate-binding domain [81824] (1 species)

7. Species Garden pea (Pisum sativum) [TaxId:3888] [81825] (3 PDB entries)

8. Domain d1p0yc1: 1p0y C:311-487 [87658]
   Other proteins in same PDB: d1p0ya2, d1p0yb2, d1p0yc2
   complexed with mlz, sah

Details for d1p0yc1

PDB Entry: 1p0y, 2.55 Å

PDB Description: crystal structure of the set domain of lsmt bound to melysine and adohcy

SCOP Domain Sequences for d1p0yc1:

Sequence; same for both SEQRES and ATOM records:

>d1p0yc1 a.166.1.1 (C:311-487) RuBisCo LSMT C-terminal, substrate-binding domain {Garden pea (Pisum sativum)}
aytltleisesdpffddkldvaesngfaqtayfdifynrtlppgllpylrlvalggtdaf
lleslfrdtiwghlelsvsrdneellckavreacksalagyhttieqdrelkegnldsrl
aiavgiregekmvlqqidgifeqkeleldqleyyqerrlkdlglcgengdilenlyf

Timeline for d1p0yc1:

• d1p0yc1 first appeared in SCOP 1.65
  
• d1p0yc1 appears in SCOP 1.69
  
• d1p0yc1 appears in the current release, SCOPe 2.08