Class a: All alpha proteins [46456] (290 folds) |
Fold a.166: RuBisCo LSMT C-terminal, substrate-binding domain [81821] (1 superfamily) multihelical; irregular array of long and short helices |
Superfamily a.166.1: RuBisCo LSMT C-terminal, substrate-binding domain [81822] (1 family) |
Family a.166.1.1: RuBisCo LSMT C-terminal, substrate-binding domain [81823] (1 protein) |
Protein RuBisCo LSMT C-terminal, substrate-binding domain [81824] (1 species) |
Species Pea (Pisum sativum) [TaxId:3888] [81825] (7 PDB entries) |
Domain d1p0yc1: 1p0y C:311-482 [87658] Other proteins in same PDB: d1p0ya2, d1p0ya3, d1p0yb2, d1p0yb3, d1p0yc2, d1p0yc3 complexed with mlz, sah |
PDB Entry: 1p0y (more details), 2.55 Å
SCOPe Domain Sequences for d1p0yc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p0yc1 a.166.1.1 (C:311-482) RuBisCo LSMT C-terminal, substrate-binding domain {Pea (Pisum sativum) [TaxId: 3888]} aytltleisesdpffddkldvaesngfaqtayfdifynrtlppgllpylrlvalggtdaf lleslfrdtiwghlelsvsrdneellckavreacksalagyhttieqdrelkegnldsrl aiavgiregekmvlqqidgifeqkeleldqleyyqerrlkdlglcgengdil
Timeline for d1p0yc1: