| Class a: All alpha proteins [46456] (202 folds) |
| Fold a.166: RuBisCo LSMT C-terminal, substrate-binding domain [81821] (1 superfamily) multihelical; irregular array of long and short helices |
Superfamily a.166.1: RuBisCo LSMT C-terminal, substrate-binding domain [81822] (1 family) ![]() |
| Family a.166.1.1: RuBisCo LSMT C-terminal, substrate-binding domain [81823] (1 protein) |
| Protein RuBisCo LSMT C-terminal, substrate-binding domain [81824] (1 species) |
| Species Garden pea (Pisum sativum) [TaxId:3888] [81825] (3 PDB entries) |
| Domain d1p0ya1: 1p0y A:311-486 [87654] Other proteins in same PDB: d1p0ya2, d1p0yb2, d1p0yc2 |
PDB Entry: 1p0y (more details), 2.55 Å
SCOP Domain Sequences for d1p0ya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p0ya1 a.166.1.1 (A:311-486) RuBisCo LSMT C-terminal, substrate-binding domain {Garden pea (Pisum sativum)}
aytltleisesdpffddkldvaesngfaqtayfdifynrtlppgllpylrlvalggtdaf
lleslfrdtiwghlelsvsrdneellckavreacksalagyhttieqdrelkegnldsrl
aiavgiregekmvlqqidgifeqkeleldqleyyqerrlkdlglcgengdilenly
Timeline for d1p0ya1:
View in 3DDomains from other chains: (mouse over for more information) d1p0yb1, d1p0yb2, d1p0yc1, d1p0yc2 |