Lineage for d1oyfa_ (1oyf A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2732921Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2733039Protein Snake phospholipase A2 [48624] (38 species)
  7. 2733242Species Snake (Daboia russellii pulchella), different isoforms [TaxId:97228] [48630] (39 PDB entries)
    Uniprot P59071
  8. 2733281Domain d1oyfa_: 1oyf A: [87595]
    complexed with acy, mhn, so4

Details for d1oyfa_

PDB Entry: 1oyf (more details), 2.45 Å

PDB Description: Crystal Structure of Russelles viper (Daboia russellii pulchella) phospholipase A2 in a complex with venom 6-methyl heptanol
PDB Compounds: (A:) phospholipase a2

SCOPe Domain Sequences for d1oyfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oyfa_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Daboia russellii pulchella), different isoforms [TaxId: 97228]}
sllefgrmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpq
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

SCOPe Domain Coordinates for d1oyfa_:

Click to download the PDB-style file with coordinates for d1oyfa_.
(The format of our PDB-style files is described here.)

Timeline for d1oyfa_: