PDB entry 1oyf

View 1oyf on RCSB PDB site
Description: Crystal Structure of Russelles viper (Daboia russellii pulchella) phospholipase A2 in a complex with venom 6-methyl heptanol
Class: Hydrolase
Keywords: Phospholipase A2, complex, Catalysis, Inhibition, Hydrolase
Deposited on 2003-04-04, released 2003-05-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.192
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Daboia russellii pulchella [TaxId:97228]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1oyfa_
  • Chain 'B':
    Compound: phospholipase a2
    Species: Daboia russellii pulchella [TaxId:97228]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OYF (0-120)
    Domains in SCOPe 2.08: d1oyfb_
  • Heterogens: SO4, MHN, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oyfA (A:)
    sllefgrmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpq
    sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
    c
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1oyfB (B:)
    sllefgkmileetgrlaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
    sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
    c