Lineage for d1owfb_ (1owf B:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1493154Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
    core: 4 helices; bundle, partly opened, capped with a beta-sheet
  4. 1493155Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) (S)
    dimer of identical subunits
  5. 1493156Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (5 proteins)
    automatically mapped to Pfam PF00216
  6. 1493188Protein Integration host factor beta subunit (IHFB) [88880] (1 species)
    heterodimer of two related subunits
  7. 1493189Species Escherichia coli [TaxId:562] [88881] (5 PDB entries)
  8. 1493190Domain d1owfb_: 1owf B: [87488]
    Other proteins in same PDB: d1owfa_
    protein/DNA complex; mutant

Details for d1owfb_

PDB Entry: 1owf (more details), 1.95 Å

PDB Description: crystal structure of a mutant ihf (betae44a) complexed with the native h' site
PDB Compounds: (B:) Integration host factor beta-subunit

SCOPe Domain Sequences for d1owfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1owfb_ a.55.1.1 (B:) Integration host factor beta subunit (IHFB) {Escherichia coli [TaxId: 562]}
mtkselierlatqqshipaktvedavkemlehmastlaqgeriairgfgsfslhyraprt
grnpktgdkvelegkyvphfkpgkelrdraniyg

SCOPe Domain Coordinates for d1owfb_:

Click to download the PDB-style file with coordinates for d1owfb_.
(The format of our PDB-style files is described here.)

Timeline for d1owfb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1owfa_