SCOPe 2.08: Domain d1owfb_: 1owf B:

Lineage for d1owfb_ (1owf B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
   core: 4 helices; bundle, partly opened, capped with a beta-sheet

4. Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families)
   dimer of identical subunits

5. Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (5 proteins)
   automatically mapped to Pfam PF00216

6. Protein Integration host factor beta subunit (IHFB) [88880] (1 species)
   heterodimer of two related subunits

7. Species Escherichia coli [TaxId:562] [88881] (5 PDB entries)

8. Domain d1owfb_: 1owf B: [87488]
   Other proteins in same PDB: d1owfa_
   protein/DNA complex; mutant

Details for d1owfb_

PDB Entry: 1owf, 1.95 Å

PDB Description: crystal structure of a mutant ihf (betae44a) complexed with the native h' site

PDB Compounds: (B:) Integration host factor beta-subunit

SCOPe Domain Sequences for d1owfb_:

Sequence; same for both SEQRES and ATOM records:

>d1owfb_ a.55.1.1 (B:) Integration host factor beta subunit (IHFB) {Escherichia coli [TaxId: 562]}
mtkselierlatqqshipaktvedavkemlehmastlaqgeriairgfgsfslhyraprt
grnpktgdkvelegkyvphfkpgkelrdraniyg

Timeline for d1owfb_:

• d1owfb_ first appeared in SCOP 1.65
  
• d1owfb_ appears in SCOPe 2.07