PDB entry 1owf
View 1owf on RCSB PDB site
Description: Crystal structure of a mutant IHF (BetaE44A) complexed with the native H' Site
Class: transcription/DNA
Keywords: protein-DNA recognition, indirect readout, IHF, DNA bending, minor groove, TRANSCRIPTION/DNA COMPLEX
Deposited on
2003-03-28, released
2003-07-15
The last revision prior to the SCOPe 2.04 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.232
AEROSPACI score: 0.42
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Integration host factor alpha-subunit
Species: Escherichia coli [TaxId:562]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d1owfa_ - Chain 'B':
Compound: Integration host factor beta-subunit
Species: Escherichia coli [TaxId:562]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d1owfb_ - Chain 'C':
Compound: Phage lambda H' site
- Chain 'D':
Compound: 5'-d(*gp*gp*cp*cp*ap*ap*ap*ap*ap*ap*gp*cp*ap*tp*t)-3'
- Chain 'E':
Compound: 5'-d(*gp*cp*tp*tp*ap*tp*cp*ap*ap*tp*tp*tp*gp*tp*tp*gp*cp*ap*cp*c)-3'
- Heterogens: HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>1owfA (A:)
maltkaemseylfdklglskrdakelvelffeeirralengeqvklsgfgnfdlrdknqr
pgrnpktgedipitarrvvtfrpgqklksrvenaspkde
Sequence, based on observed residues (ATOM records): (download)
>1owfA (A:)
altkaemseylfdklglskrdakelvelffeeirralengeqvklsgfgnfdlrdknqrp
grnpktgedipitarrvvtfrpgqklksrvenaspk
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1owfB (B:)
mtkselierlatqqshipaktvedavkemlehmastlaqgeriairgfgsfslhyraprt
grnpktgdkvelegkyvphfkpgkelrdraniyg
- Chain 'C':
No sequence available.
- Chain 'D':
No sequence available.
- Chain 'E':
No sequence available.