Lineage for d1ow0b1 (1ow0 B:242-342)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 453240Protein Immunoglobulin heavy chain alpha constant domain 2, CH2-alpha [89181] (1 species)
  7. 453241Species Human (Homo sapiens) [TaxId:9606] [89182] (1 PDB entry)
  8. 453243Domain d1ow0b1: 1ow0 B:242-342 [87479]
    Other proteins in same PDB: d1ow0a2, d1ow0b2, d1ow0c1, d1ow0c2, d1ow0d1, d1ow0d2

Details for d1ow0b1

PDB Entry: 1ow0 (more details), 3.1 Å

PDB Description: crystal structure of human fcari bound to iga1-fc

SCOP Domain Sequences for d1ow0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ow0b1 b.1.1.2 (B:242-342) Immunoglobulin heavy chain alpha constant domain 2, CH2-alpha {Human (Homo sapiens)}
chprlslhrpaledlllgseanltctltglrdasgvtftwtpssgksavqgpperdlcgc
ysvssvlpgcaepwnhgktftctaaypesktpltatlsksg

SCOP Domain Coordinates for d1ow0b1:

Click to download the PDB-style file with coordinates for d1ow0b1.
(The format of our PDB-style files is described here.)

Timeline for d1ow0b1: