SCOP 1.67: Domain d1ow0b1: 1ow0 B:242-342

Lineage for d1ow0b1 (1ow0 B:242-342)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain alpha constant domain 2, CH2-alpha [89181] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89182] (1 PDB entry)

8. Domain d1ow0b1: 1ow0 B:242-342 [87479]
   Other proteins in same PDB: d1ow0a2, d1ow0b2, d1ow0c1, d1ow0c2, d1ow0d1, d1ow0d2
   complexed with fuc, gal, man, nag, sia

Details for d1ow0b1

PDB Entry: 1ow0, 3.1 Å

PDB Description: crystal structure of human fcari bound to iga1-fc

SCOP Domain Sequences for d1ow0b1:

Sequence; same for both SEQRES and ATOM records:

>d1ow0b1 b.1.1.2 (B:242-342) Immunoglobulin heavy chain alpha constant domain 2, CH2-alpha {Human (Homo sapiens)}
chprlslhrpaledlllgseanltctltglrdasgvtftwtpssgksavqgpperdlcgc
ysvssvlpgcaepwnhgktftctaaypesktpltatlsksg

Timeline for d1ow0b1:

• d1ow0b1 first appeared in SCOP 1.65
  
• d1ow0b1 appears in SCOP 1.69
  
• d1ow0b1 appears in the current release, SCOPe 2.08