Lineage for d1ow0b1 (1ow0 B:242-342)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289073Protein Immunoglobulin heavy chain alpha constant domain 2, CH2-alpha [89181] (1 species)
  7. 289074Species Human (Homo sapiens) [TaxId:9606] [89182] (1 PDB entry)
  8. 289076Domain d1ow0b1: 1ow0 B:242-342 [87479]
    Other proteins in same PDB: d1ow0a2, d1ow0b2, d1ow0c1, d1ow0c2, d1ow0d1, d1ow0d2
    complexed with fuc, gal, man, nag, sia

Details for d1ow0b1

PDB Entry: 1ow0 (more details), 3.1 Å

PDB Description: Crystal structure of human FcaRI bound to IgA1-Fc

SCOP Domain Sequences for d1ow0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ow0b1 b.1.1.2 (B:242-342) Immunoglobulin heavy chain alpha constant domain 2, CH2-alpha {Human (Homo sapiens)}
chprlslhrpaledlllgseanltctltglrdasgvtftwtpssgksavqgpperdlcgc
ysvssvlpgcaepwnhgktftctaaypesktpltatlsksg

SCOP Domain Coordinates for d1ow0b1:

Click to download the PDB-style file with coordinates for d1ow0b1.
(The format of our PDB-style files is described here.)

Timeline for d1ow0b1: