SCOP 1.71: Domain d1orqa1: 1orq A:1-108

Lineage for d1orqa1 (1orq A:1-108)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.1 [TaxId:10090] [88527] (12 PDB entries)

8. Domain d1orqa1: 1orq A:1-108 [87344]
   Other proteins in same PDB: d1orqa2, d1orqb1, d1orqb2, d1orqc_
   part of anti-VD potassium channel KVAP Fab 6E1
   complexed with cd, k; mutant

Details for d1orqa1

PDB Entry: 1orq, 3.2 Å

PDB Description: x-ray structure of a voltage-dependent potassium channel in complex with an fab

SCOP Domain Sequences for d1orqa1:

Sequence; same for both SEQRES and ATOM records:

>d1orqa1 b.1.1.1 (A:1-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.1}
envltqspaimspspgekvtmtcrarssvsssylhwyqqksgaspklwiystsnlasgvp
arfsgsgsgtsysltissveaedtatyycqqysgnpwtfgggtkleik

Timeline for d1orqa1:

• d1orqa1 first appeared in SCOP 1.65
  
• d1orqa1 appears in SCOP 1.69
  
• d1orqa1 appears in SCOP 1.73
  
• d1orqa1 appears in the current release, SCOPe 2.08