![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88576] (302 PDB entries) |
![]() | Domain d1orqb2: 1orq B:119-219 [87347] Other proteins in same PDB: d1orqa1, d1orqa2, d1orqb1, d1orqc_ part of anti-VD potassium channel KVAP Fab 6E1 complexed with cd, k; mutant |
PDB Entry: 1orq (more details), 3.2 Å
SCOP Domain Sequences for d1orqb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1orqb2 b.1.1.2 (B:119-219) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)} akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpallqsd lytlsssvtvtsntwpsqsitcnvahpasstkvdkkivprd
Timeline for d1orqb2: