![]() | Class f: Membrane and cell surface proteins and peptides [56835] (49 folds) |
![]() | Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily) oligomeric transmembrane alpha-helical proteins |
![]() | Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family) ![]() |
![]() | Family f.14.1.1: Voltage-gated potassium channels [81323] (5 proteins) |
![]() | Protein Potassium channel KVAP [90107] (1 species) |
![]() | Species Archaeon Aeropyrum pernix [TaxId:56636] [90108] (2 PDB entries) |
![]() | Domain d1orqc_: 1orq C: [87348] Other proteins in same PDB: d1orqa1, d1orqa2, d1orqb1, d1orqb2 gate and perimeter subdomains complexed with cd, k; mutant |
PDB Entry: 1orq (more details), 3.2 Å
SCOP Domain Sequences for d1orqc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1orqc_ f.14.1.1 (C:) Potassium channel KVAP {Archaeon Aeropyrum pernix} igdvmehplvelgvsyaallsvivvvvectmqlsgeylvrlylvdlilviilwadyayra yksgdpagyvkktlyeipalvpagllalieghlaglglfrlvrllrflrilliisrgskf lsaiadaadkirfyhlfgavmltvlygafaiyiveypdpnssiksvfdalwwavvtattv gygdvvpatpigkvigiavmltgisaltlligtvsnmfqkilv
Timeline for d1orqc_:
![]() Domains from other chains: (mouse over for more information) d1orqa1, d1orqa2, d1orqb1, d1orqb2 |