| Class b: All beta proteins [48724] (177 folds) |
| Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) ![]() |
| Family b.42.2.1: Ricin B-like [50371] (11 proteins) |
| Protein Plant cytotoxin B-chain (lectin) [50372] (5 species) duplication: consists of two domains of this fold |
| Species European mistletoe (Viscum album) [TaxId:3972] [50375] (12 PDB entries) different sequence variants Uniprot Q6ITZ3 266-520; Uniprot P81446 269-531 # 91% sequence identity |
| Domain d1oqlb2: 1oql B:138-263 [87308] Other proteins in same PDB: d1oqla_ complexed with gal, nag |
PDB Entry: 1oql (more details), 3 Å
SCOPe Domain Sequences for d1oqlb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oqlb2 b.42.2.1 (B:138-263) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]}
taprevtiygfrdlcmesnggsvwvetcvssqknqrwalygdgsirpkqnqdqcltcgrd
svstvinivscsagssgqrwvftnegailnlknglamdvaqanpklrriiiypatgkpnq
mwlpvp
Timeline for d1oqlb2: