SCOP 1.65: Domain d1oqlb2: 1oql B:138-263

Lineage for d1oqlb2 (1oql B:138-263)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.42: beta-Trefoil [50352] (6 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (2 families)

5. Family b.42.2.1: Ricin B-like [50371] (2 proteins)

6. Protein Plant cytotoxin B-chain (lectin) [50372] (5 species)
   duplication: consists of two domains of this fold

7. Species European mistletoe (Viscum album) [TaxId:3972] [50375] (4 PDB entries)
   different sequence variants

8. Domain d1oqlb2: 1oql B:138-263 [87308]
   Other proteins in same PDB: d1oqla_
   complexed with gal, nag

Details for d1oqlb2

PDB Entry: 1oql, 3 Å

PDB Description: mistletoe lectin i from viscum album complexed with galactose

SCOP Domain Sequences for d1oqlb2:

Sequence; same for both SEQRES and ATOM records:

>d1oqlb2 b.42.2.1 (B:138-263) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album)}
taprevtiygfrdlcmesnggsvwvetcvssqknqrwalygdgsirpkqnqdqcltcgrd
svstvinivscsagssgqrwvftnegailnlknglamdvaqanpklrriiiypatgkpnq
mwlpvp

Timeline for d1oqlb2:

• d1oqlb2 is new in SCOP 1.65
  
• d1oqlb2 appears in SCOP 1.67
  
• d1oqlb2 appears in the current release, SCOPe 2.08