SCOPe 2.05: Domain d1oplb1: 1opl B:140-237

Lineage for d1oplb1 (1opl B:140-237)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein Abl tyrosine kinase [55581] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55582] (2 PDB entries)

8. Domain d1oplb1: 1opl B:140-237 [87238]
   Other proteins in same PDB: d1opla1, d1opla3, d1oplb2
   complexed with myr, p16

Details for d1oplb1

PDB Entry: 1opl, 3.42 Å

PDB Description: structural basis for the auto-inhibition of c-abl tyrosine kinase

PDB Compounds: (B:) proto-oncogene tyrosine-protein kinase

SCOPe Domain Sequences for d1oplb1:

Sequence; same for both SEQRES and ATOM records:

>d1oplb1 d.93.1.1 (B:140-237) Abl tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
slekhswyhgpvsrnaaeyllssgingsflvresesspgqrsislryegrvyhyrintas
dgklyvssesrfntlaelvhhhstvadglittlhypap

Timeline for d1oplb1:

• d1oplb1 first appeared in SCOP 1.65
  
• d1oplb1 appears in SCOPe 2.04
  
• d1oplb1 appears in SCOPe 2.06
  
• d1oplb1 appears in the current release, SCOPe 2.08