![]() | Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
![]() | Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices |
![]() | Superfamily d.93.1: SH2 domain [55550] (1 family) ![]() |
![]() | Family d.93.1.1: SH2 domain [55551] (25 proteins) |
![]() | Protein Abl tyrosine kinase [55581] (2 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [89998] (2 PDB entries) |
![]() | Domain d1oplb1: 1opl B:140-237 [87238] Other proteins in same PDB: d1opla1, d1opla3, d1oplb2 complexed with myr, p16; mutant |
PDB Entry: 1opl (more details), 3.42 Å
SCOP Domain Sequences for d1oplb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oplb1 d.93.1.1 (B:140-237) Abl tyrosine kinase {Mouse (Mus musculus)} slekhswyhgpvsrnaaeyllssgingsflvresesspgqrsislryegrvyhyrintas dgklyvssesrfntlaelvhhhstvadglittlhypap
Timeline for d1oplb1: