SCOPe 2.05: Domain d1opla1: 1opl A:81-139

Lineage for d1opla1 (1opl A:81-139)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein Abl tyrosine kinase, SH3 domain [50052] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50054] (6 PDB entries)

8. Domain d1opla1: 1opl A:81-139 [87235]
   Other proteins in same PDB: d1opla2, d1opla3, d1oplb1, d1oplb2
   complexed with myr, p16

Details for d1opla1

PDB Entry: 1opl, 3.42 Å

PDB Description: structural basis for the auto-inhibition of c-abl tyrosine kinase

PDB Compounds: (A:) proto-oncogene tyrosine-protein kinase

SCOPe Domain Sequences for d1opla1:

Sequence; same for both SEQRES and ATOM records:

>d1opla1 b.34.2.1 (A:81-139) Abl tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]}
dpnlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsnyitpvn

Timeline for d1opla1:

• d1opla1 first appeared in SCOP 1.65
  
• d1opla1 appears in SCOPe 2.04
  
• d1opla1 appears in SCOPe 2.06
  
• d1opla1 appears in the current release, SCOPe 2.08