Lineage for d1on0b1 (1on0 B:2-156)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2209196Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2209197Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2209198Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2209509Protein Putative acetyltransferase YycN [90011] (1 species)
  7. 2209510Species Bacillus subtilis [TaxId:1423] [90012] (2 PDB entries)
  8. 2209514Domain d1on0b1: 1on0 B:2-156 [87096]
    Other proteins in same PDB: d1on0a2, d1on0b2, d1on0c2, d1on0d2
    structural genomics; target SR144
    complexed with cl, so4

Details for d1on0b1

PDB Entry: 1on0 (more details), 2.2 Å

PDB Description: crystal structure of putative acetyltransferase (yycn) from bacillus subtilis, northeast structural genomics consortium target sr144
PDB Compounds: (B:) YycN protein

SCOPe Domain Sequences for d1on0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1on0b1 d.108.1.1 (B:2-156) Putative acetyltransferase YycN {Bacillus subtilis [TaxId: 1423]}
timltpmqteefrsyltyttkhyaeekvkagtwlpedaqllskqvftdllprgletphhh
lwslklnekdivgwlwihaepehpqqeafiydfglyepyrgkgyakqalaaldqaarsmg
irklslhvfahnqtarklyeqtgfqetdvvmskkl

SCOPe Domain Coordinates for d1on0b1:

Click to download the PDB-style file with coordinates for d1on0b1.
(The format of our PDB-style files is described here.)

Timeline for d1on0b1: