Lineage for d1on0b_ (1on0 B:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 333011Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 333012Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (4 families) (S)
  5. 333013Family d.108.1.1: N-acetyl transferase, NAT [55730] (14 proteins)
  6. 333097Protein Putative acetyltransferase YycN [90011] (1 species)
  7. 333098Species Bacillus subtilis [TaxId:1423] [90012] (2 PDB entries)
  8. 333102Domain d1on0b_: 1on0 B: [87096]

Details for d1on0b_

PDB Entry: 1on0 (more details), 2.2 Å

PDB Description: crystal structure of putative acetyltransferase (yycn) from bacillus subtilis, northeast structural genomics consortium target sr144

SCOP Domain Sequences for d1on0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1on0b_ d.108.1.1 (B:) Putative acetyltransferase YycN {Bacillus subtilis}
timltpmqteefrsyltyttkhyaeekvkagtwlpedaqllskqvftdllprgletphhh
lwslklnekdivgwlwihaepehpqqeafiydfglyepyrgkgyakqalaaldqaarsmg
irklslhvfahnqtarklyeqtgfqetdvvmskklle

SCOP Domain Coordinates for d1on0b_:

Click to download the PDB-style file with coordinates for d1on0b_.
(The format of our PDB-style files is described here.)

Timeline for d1on0b_: