Lineage for d1o9fa_ (1o9f A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
    automatically mapped to Pfam PF00244
  5. Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)
  6. 1501342Protein 14-3-3-like protein C [89132] (1 species)
  7. 1501343Species Tobacco (Nicotiana tabacum) [TaxId:4097] [89133] (5 PDB entries)
  8. 1501347Domain d1o9fa_: 1o9f A: [86691]
    complex with a proton ATPase peptide, chain P
    complexed with fsc

Details for d1o9fa_

PDB Entry: 1o9f (more details), 2.7 Å

PDB Description: structural view of a fungal toxin acting on a 14-3-3 regulatory complex
PDB Compounds: (A:) 14-3-3-like protein c

SCOPe Domain Sequences for d1o9fa_:

Sequence, based on SEQRES records: (download)

>d1o9fa_ a.118.7.1 (A:) 14-3-3-like protein C {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
ptareenvymaklaeqaeryeemvefmekvsnslgseeltveernllsvayknvigarra
swriissieqkeesrgneehvnsireyrskienelskicdgilklldaklipsaasgdsk
vfylkmkgdyhrylaefktgaerkeaaestltaykaaqdiattelapthpirlglalnfs
vfyyeilnspdracnlakqafdeaiaeldtlgeesykdstlimqllrdnltlwtsd

Sequence, based on observed residues (ATOM records): (download)

>d1o9fa_ a.118.7.1 (A:) 14-3-3-like protein C {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
ptareenvymaklaeqaeryeemvefmekvsnslgseeltveernllsvayknvigarra
swriissieqkeesrgneehvnsireyrskienelskicdgilklldaklipsaasgdsk
vfylkmkgdyhrylaefktgaerkeaaestltaykaaqdiattelapthpirlglalnfs
vfyyeilnspdracnlakqafdeaiaeldtlgykdstlimqllrdnltlwtsd

SCOPe Domain Coordinates for d1o9fa_:

Click to download the PDB-style file with coordinates for d1o9fa_.
(The format of our PDB-style files is described here.)

Timeline for d1o9fa_: