SCOPe 2.05: Domain d1o9fa_: 1o9f A:

Lineage for d1o9fa_ (1o9f A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.7: 14-3-3 protein [48445] (1 family)
   automatically mapped to Pfam PF00244

5. Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)

6. Protein 14-3-3-like protein C [89132] (1 species)

7. Species Tobacco (Nicotiana tabacum) [TaxId:4097] [89133] (5 PDB entries)

8. Domain d1o9fa_: 1o9f A: [86691]
   complex with a proton ATPase peptide, chain P
   complexed with fsc

Details for d1o9fa_

PDB Entry: 1o9f, 2.7 Å

PDB Description: structural view of a fungal toxin acting on a 14-3-3 regulatory complex

PDB Compounds: (A:) 14-3-3-like protein c

SCOPe Domain Sequences for d1o9fa_:

Sequence, based on SEQRES records:

>d1o9fa_ a.118.7.1 (A:) 14-3-3-like protein C {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
ptareenvymaklaeqaeryeemvefmekvsnslgseeltveernllsvayknvigarra
swriissieqkeesrgneehvnsireyrskienelskicdgilklldaklipsaasgdsk
vfylkmkgdyhrylaefktgaerkeaaestltaykaaqdiattelapthpirlglalnfs
vfyyeilnspdracnlakqafdeaiaeldtlgeesykdstlimqllrdnltlwtsd

Sequence, based on observed residues (ATOM records):

>d1o9fa_ a.118.7.1 (A:) 14-3-3-like protein C {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
ptareenvymaklaeqaeryeemvefmekvsnslgseeltveernllsvayknvigarra
swriissieqkeesrgneehvnsireyrskienelskicdgilklldaklipsaasgdsk
vfylkmkgdyhrylaefktgaerkeaaestltaykaaqdiattelapthpirlglalnfs
vfyyeilnspdracnlakqafdeaiaeldtlgykdstlimqllrdnltlwtsd

Timeline for d1o9fa_:

• d1o9fa_ first appeared in SCOP 1.65
  
• d1o9fa_ appears in SCOPe 2.04
  
• d1o9fa_ appears in SCOPe 2.06
  
• d1o9fa_ appears in the current release, SCOPe 2.08