Lineage for d1o0pa_ (1o0p A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1652149Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1652150Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1652530Protein Splicing factor U2AF 65 KDa subunit [54936] (2 species)
  7. 1652531Species Human (Homo sapiens) [TaxId:9606] [54937] (7 PDB entries)
  8. 1652537Domain d1o0pa_: 1o0p A: [86535]
    third RNA-binding domain; complexed with an N-terminal Sf1/Mbbp peptide, chain B
    protein/RNA complex

Details for d1o0pa_

PDB Entry: 1o0p (more details)

PDB Description: solution structure of the third rna recognition motif (rrm) of u2af65 in complex with an n-terminal sf1 peptide
PDB Compounds: (A:) splicing factor u2af 65 kda subunit

SCOPe Domain Sequences for d1o0pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]}
ghptevlclmnmvlpeellddeeyeeivedvrdecskyglvksieiprpvdgvevpgcgk
ifveftsvfdcqkamqgltgrkfanrvvvtkycdpdsyhrrdfw

SCOPe Domain Coordinates for d1o0pa_:

Click to download the PDB-style file with coordinates for d1o0pa_.
(The format of our PDB-style files is described here.)

Timeline for d1o0pa_: