Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) |
Family d.58.7.1: Canonical RBD [54929] (68 proteins) |
Protein Splicing factor U2AF 65 KDa subunit [54936] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [54937] (6 PDB entries) |
Domain d1o0pa_: 1o0p A: [86535] third RNA-binding domain; complexed with an N-terminal Sf1/Mbbp peptide, chain B protein/RNA complex |
PDB Entry: 1o0p (more details)
SCOPe Domain Sequences for d1o0pa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} ghptevlclmnmvlpeellddeeyeeivedvrdecskyglvksieiprpvdgvevpgcgk ifveftsvfdcqkamqgltgrkfanrvvvtkycdpdsyhrrdfw
Timeline for d1o0pa_: