SCOPe 2.04: Domain d1nvtb1: 1nvt B:111-287

Lineage for d1nvtb1 (1nvt B:111-287)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
   extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site

6. Protein Shikimate 5-dehydrogenase AroE [89538] (6 species)

7. Species Methanococcus jannaschii [TaxId:2190] [89540] (1 PDB entry)
   MJ1084

8. Domain d1nvtb1: 1nvt B:111-287 [86272]
   Other proteins in same PDB: d1nvta2, d1nvtb2
   structural genomics
   complexed with nap, zn

Details for d1nvtb1

PDB Entry: 1nvt, 2.35 Å

PDB Description: crystal structure of shikimate dehydrogenase (aroe or mj1084) in complex with nadp+

PDB Compounds: (B:) Shikimate 5'-dehydrogenase

SCOPe Domain Sequences for d1nvtb1:

Sequence; same for both SEQRES and ATOM records:

>d1nvtb1 c.2.1.7 (B:111-287) Shikimate 5-dehydrogenase AroE {Methanococcus jannaschii [TaxId: 2190]}
dgigarmaleeeigrvkdkniviygaggaaravafelakdnniiianrtvekaealakei
aeklnkkfgeevkfsgldvdldgvdiiinatpigmypnidvepivkaeklredmvvmdli
ynpletvllkeakkvnaktinglgmliyqgavafkiwtgvepnievmknaiidkitk

Timeline for d1nvtb1:

• d1nvtb1 first appeared in SCOP 1.65
  
• d1nvtb1 appears in SCOPe 2.03
  
• d1nvtb1 appears in SCOPe 2.05
  
• d1nvtb1 appears in the current release, SCOPe 2.08