Lineage for d1nvta2 (1nvt A:1-110)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1610013Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 1610014Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 1610269Family c.58.1.5: Shikimate dehydrogenase-like [82336] (3 proteins)
  6. 1610278Protein Shikimate 5-dehydrogenase AroE [89584] (6 species)
  7. 1610306Species Methanococcus jannaschii [TaxId:2190] [89586] (1 PDB entry)
    MJ1084
  8. 1610307Domain d1nvta2: 1nvt A:1-110 [86271]
    Other proteins in same PDB: d1nvta1, d1nvtb1
    structural genomics
    complexed with nap, zn

Details for d1nvta2

PDB Entry: 1nvt (more details), 2.35 Å

PDB Description: crystal structure of shikimate dehydrogenase (aroe or mj1084) in complex with nadp+
PDB Compounds: (A:) Shikimate 5'-dehydrogenase

SCOPe Domain Sequences for d1nvta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nvta2 c.58.1.5 (A:1-110) Shikimate 5-dehydrogenase AroE {Methanococcus jannaschii [TaxId: 2190]}
gplgsminaktkviglighpvehsfspimhnaafkdkglnyvyvafdvlpenlkyvidga
kalgivgfnvtiphkieimkyldeidkdaqligavntikiedgkaigynt

SCOPe Domain Coordinates for d1nvta2:

Click to download the PDB-style file with coordinates for d1nvta2.
(The format of our PDB-style files is described here.)

Timeline for d1nvta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nvta1