Lineage for d1nslf1 (1nsl F:1-179)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2209196Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2209197Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2209198Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2209439Protein Probable acetyltransferase YdaF [90015] (1 species)
  7. 2209440Species Bacillus subtilis [TaxId:1423] [90016] (1 PDB entry)
  8. 2209446Domain d1nslf1: 1nsl F:1-179 [86142]
    Other proteins in same PDB: d1nsla2, d1nslb2, d1nslc2, d1nsld2, d1nsle2, d1nslf2
    structural genomics
    complexed with cl

Details for d1nslf1

PDB Entry: 1nsl (more details), 2.7 Å

PDB Description: Crystal structure of Probable acetyltransferase
PDB Compounds: (F:) Probable acetyltransferase

SCOPe Domain Sequences for d1nslf1:

Sequence, based on SEQRES records: (download)

>d1nslf1 d.108.1.1 (F:1-179) Probable acetyltransferase YdaF {Bacillus subtilis [TaxId: 1423]}
mftckvnehitirllepkdaerlaeliiqnqqrlgkwlffaenpssadtyretiipdwrr
qyadlngieagllydgslcgmislhnldqvnrkaeigywiakefegkgiitaacrklity
afeelelnrvaicaavgneksravperigfleegkardglyvngmhhdlvyysllkrew

Sequence, based on observed residues (ATOM records): (download)

>d1nslf1 d.108.1.1 (F:1-179) Probable acetyltransferase YdaF {Bacillus subtilis [TaxId: 1423]}
mftckvnehitirllepkdaerlaeliiqnqqrlgkwlffpssadtyretiipdwrrqya
dlngieagllydgslcgmislhnldqvnrkaeigywiakefegkgiitaacrklityafe
elelnrvaicaavgneksravperigfleegkardglyvngmhhdlvyysllkrew

SCOPe Domain Coordinates for d1nslf1:

Click to download the PDB-style file with coordinates for d1nslf1.
(The format of our PDB-style files is described here.)

Timeline for d1nslf1: