SCOPe 2.06: Domain d1nsle1: 1nsl E:1-179

Lineage for d1nsle1 (1nsl E:1-179)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)

6. Protein Probable acetyltransferase YdaF [90015] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [90016] (1 PDB entry)

8. Domain d1nsle1: 1nsl E:1-179 [86141]
   Other proteins in same PDB: d1nsla2, d1nslb2, d1nslc2, d1nsld2, d1nsle2, d1nslf2
   structural genomics
   complexed with cl

Details for d1nsle1

PDB Entry: 1nsl, 2.7 Å

PDB Description: Crystal structure of Probable acetyltransferase

PDB Compounds: (E:) Probable acetyltransferase

SCOPe Domain Sequences for d1nsle1:

Sequence, based on SEQRES records:

>d1nsle1 d.108.1.1 (E:1-179) Probable acetyltransferase YdaF {Bacillus subtilis [TaxId: 1423]}
mftckvnehitirllepkdaerlaeliiqnqqrlgkwlffaenpssadtyretiipdwrr
qyadlngieagllydgslcgmislhnldqvnrkaeigywiakefegkgiitaacrklity
afeelelnrvaicaavgneksravperigfleegkardglyvngmhhdlvyysllkrew

Sequence, based on observed residues (ATOM records):

>d1nsle1 d.108.1.1 (E:1-179) Probable acetyltransferase YdaF {Bacillus subtilis [TaxId: 1423]}
mftckvnehitirllepkdaerlaeliiqnqqrlgkwlffenpssadtyretiipdwrrq
yadlngieagllydgslcgmislhnldqvnrkaeigywiakefegkgiitaacrklitya
feelelnrvaicaavgneksravperigfleegkardglyvngmhhdlvyysllkrew

Timeline for d1nsle1:

• d1nsle1 first appeared in SCOP 1.65, called d1nsle_
  
• d1nsle1 was called d1nsle_ in SCOPe 2.05
  
• d1nsle1 appears in SCOPe 2.07
  
• d1nsle1 appears in the current release, SCOPe 2.08