![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
![]() | Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) |
![]() | Protein Probable acetyltransferase YdaF [90015] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [90016] (1 PDB entry) |
![]() | Domain d1nsle_: 1nsl E: [86141] structural genomics complexed with cl |
PDB Entry: 1nsl (more details), 2.7 Å
SCOPe Domain Sequences for d1nsle_:
Sequence, based on SEQRES records: (download)
>d1nsle_ d.108.1.1 (E:) Probable acetyltransferase YdaF {Bacillus subtilis [TaxId: 1423]} gmftckvnehitirllepkdaerlaeliiqnqqrlgkwlffaenpssadtyretiipdwr rqyadlngieagllydgslcgmislhnldqvnrkaeigywiakefegkgiitaacrklit yafeelelnrvaicaavgneksravperigfleegkardglyvngmhhdlvyysllkrew
>d1nsle_ d.108.1.1 (E:) Probable acetyltransferase YdaF {Bacillus subtilis [TaxId: 1423]} gmftckvnehitirllepkdaerlaeliiqnqqrlgkwlffenpssadtyretiipdwrr qyadlngieagllydgslcgmislhnldqvnrkaeigywiakefegkgiitaacrklity afeelelnrvaicaavgneksravperigfleegkardglyvngmhhdlvyysllkrew
Timeline for d1nsle_: