Lineage for d1nsla_ (1nsl A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1664276Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1664277Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1664278Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 1664517Protein Probable acetyltransferase YdaF [90015] (1 species)
  7. 1664518Species Bacillus subtilis [TaxId:1423] [90016] (1 PDB entry)
  8. 1664519Domain d1nsla_: 1nsl A: [86137]
    structural genomics
    complexed with cl

Details for d1nsla_

PDB Entry: 1nsl (more details), 2.7 Å

PDB Description: Crystal structure of Probable acetyltransferase
PDB Compounds: (A:) Probable acetyltransferase

SCOPe Domain Sequences for d1nsla_:

Sequence, based on SEQRES records: (download)

>d1nsla_ d.108.1.1 (A:) Probable acetyltransferase YdaF {Bacillus subtilis [TaxId: 1423]}
gmftckvnehitirllepkdaerlaeliiqnqqrlgkwlffaenpssadtyretiipdwr
rqyadlngieagllydgslcgmislhnldqvnrkaeigywiakefegkgiitaacrklit
yafeelelnrvaicaavgneksravperigfleegkardglyvngmhhdlvyysllkrew

Sequence, based on observed residues (ATOM records): (download)

>d1nsla_ d.108.1.1 (A:) Probable acetyltransferase YdaF {Bacillus subtilis [TaxId: 1423]}
gmftckvnehitirllepkdaerlaeliiqnqqrlgkwlffssadtyretiipdwrrqya
dlngieagllydgslcgmislhnldqvnrkaeigywiakefegkgiitaacrklityafe
elelnrvaicaavgneksravperigfleegkardglyvngmhhdlvyysllkrew

SCOPe Domain Coordinates for d1nsla_:

Click to download the PDB-style file with coordinates for d1nsla_.
(The format of our PDB-style files is described here.)

Timeline for d1nsla_: