SCOPe 2.05: Domain d1nsle_: 1nsl E:

Lineage for d1nsle_ (1nsl E:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)

6. Protein Probable acetyltransferase YdaF [90015] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [90016] (1 PDB entry)

8. Domain d1nsle_: 1nsl E: [86141]
   structural genomics
   complexed with cl

Details for d1nsle_

PDB Entry: 1nsl, 2.7 Å

PDB Description: Crystal structure of Probable acetyltransferase

PDB Compounds: (E:) Probable acetyltransferase

SCOPe Domain Sequences for d1nsle_:

Sequence, based on SEQRES records:

>d1nsle_ d.108.1.1 (E:) Probable acetyltransferase YdaF {Bacillus subtilis [TaxId: 1423]}
gmftckvnehitirllepkdaerlaeliiqnqqrlgkwlffaenpssadtyretiipdwr
rqyadlngieagllydgslcgmislhnldqvnrkaeigywiakefegkgiitaacrklit
yafeelelnrvaicaavgneksravperigfleegkardglyvngmhhdlvyysllkrew

Sequence, based on observed residues (ATOM records):

>d1nsle_ d.108.1.1 (E:) Probable acetyltransferase YdaF {Bacillus subtilis [TaxId: 1423]}
gmftckvnehitirllepkdaerlaeliiqnqqrlgkwlffenpssadtyretiipdwrr
qyadlngieagllydgslcgmislhnldqvnrkaeigywiakefegkgiitaacrklity
afeelelnrvaicaavgneksravperigfleegkardglyvngmhhdlvyysllkrew

Timeline for d1nsle_:

• d1nsle_ first appeared in SCOP 1.65
  
• d1nsle_ appears in SCOPe 2.04
  
• d1nsle_ is called d1nsle1 in SCOPe 2.06
  
• d1nsle_ appears in the current release, SCOPe 2.08, called d1nsle1