SCOPe 2.07: Domain d1nayb1: 1nay B:216-261

Lineage for d1nayb1 (1nay B:216-261)

1. Root: SCOPe 2.07

2. Class k: Designed proteins [58788] (44 folds)

3. Fold k.3: Collagen-like peptides [58805] (1 superfamily)

4. Superfamily k.3.1: Collagen-like peptides [58806] (1 family)

5. Family k.3.1.1: Collagen-like peptides [58807] (1 protein)

6. Protein Collagen-like peptides [58808] (8 species)

7. Species Synthetic, [(pro-pro-gly)10]3 triple helix model [70052] (2 PDB entries)

8. Domain d1nayb1: 1nay B:216-261 [85503]
   Other proteins in same PDB: d1nayb2
   foldon is a trimerisation domain of T4 fibritin

Details for d1nayb1

PDB Entry: 1nay, 2.6 Å

PDB Description: gpp-foldon:x-ray structure

PDB Compounds: (B:) collagen-like peptide

SCOPe Domain Sequences for d1nayb1:

Sequence; same for both SEQRES and ATOM records:

>d1nayb1 k.3.1.1 (B:216-261) Collagen-like peptides {Synthetic, [(pro-pro-gly)10]3 triple helix model}
ppgppgppgppgppgppgsgyipeaprdgqayvrkdgewvllstfl

Timeline for d1nayb1:

• d1nayb1 first appeared in SCOP 1.65, called d1nayb_
  
• d1nayb1 was called d1nayb_ in SCOPe 2.06
  
• d1nayb1 appears in the current release, SCOPe 2.08