Lineage for d1nayb1 (1nay B:216-261)

  1. Root: SCOPe 2.08
  2. 3047812Class k: Designed proteins [58788] (44 folds)
  3. 3047854Fold k.3: Collagen-like peptides [58805] (1 superfamily)
  4. 3047855Superfamily k.3.1: Collagen-like peptides [58806] (1 family) (S)
  5. 3047856Family k.3.1.1: Collagen-like peptides [58807] (1 protein)
  6. 3047857Protein Collagen-like peptides [58808] (8 species)
  7. 3047907Species Synthetic, [(pro-pro-gly)10]3 triple helix model [70052] (2 PDB entries)
  8. 3047915Domain d1nayb1: 1nay B:216-261 [85503]
    Other proteins in same PDB: d1naya2, d1nayb2, d1nayc2
    foldon is a trimerisation domain of T4 fibritin

Details for d1nayb1

PDB Entry: 1nay (more details), 2.6 Å

PDB Description: gpp-foldon:x-ray structure
PDB Compounds: (B:) collagen-like peptide

SCOPe Domain Sequences for d1nayb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nayb1 k.3.1.1 (B:216-261) Collagen-like peptides {Synthetic, [(pro-pro-gly)10]3 triple helix model}
ppgppgppgppgppgppgsgyipeaprdgqayvrkdgewvllstfl

SCOPe Domain Coordinates for d1nayb1:

Click to download the PDB-style file with coordinates for d1nayb1.
(The format of our PDB-style files is described here.)

Timeline for d1nayb1: