Lineage for d1n8ja_ (1n8j A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877441Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2877472Protein Alkyl hydroperoxide reductase AhpC [69516] (5 species)
  7. 2877530Species Salmonella typhimurium [TaxId:90371] [69517] (6 PDB entries)
  8. 2877531Domain d1n8ja_: 1n8j A: [85401]

Details for d1n8ja_

PDB Entry: 1n8j (more details), 2.17 Å

PDB Description: crystal structure of ahpc with active site cysteine mutated to serine (c46s)
PDB Compounds: (A:) Alkyl hydroperoxide reductase C22 protein

SCOPe Domain Sequences for d1n8ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n8ja_ c.47.1.10 (A:) Alkyl hydroperoxide reductase AhpC {Salmonella typhimurium [TaxId: 90371]}
slintkikpfknqafkngefievtekdtegrwsvfffypadftfvsptelgdvadhyeel
qklgvdvysvstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladra
tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevcpakwkegeatlapsl
dlvgki

SCOPe Domain Coordinates for d1n8ja_:

Click to download the PDB-style file with coordinates for d1n8ja_.
(The format of our PDB-style files is described here.)

Timeline for d1n8ja_: