Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
Protein Alkyl hydroperoxide reductase AhpC [69516] (5 species) |
Species Salmonella typhimurium [TaxId:90371] [69517] (6 PDB entries) |
Domain d1n8jq_: 1n8j Q: [85417] |
PDB Entry: 1n8j (more details), 2.17 Å
SCOPe Domain Sequences for d1n8jq_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n8jq_ c.47.1.10 (Q:) Alkyl hydroperoxide reductase AhpC {Salmonella typhimurium [TaxId: 90371]} slintkikpfknqafkngefievtekdtegrwsvfffypadftfvsptelgdvadhyeel qklgvdvysvstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladra tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevcpakwkegeatlapsl dlvgki
Timeline for d1n8jq_: