Class a: All alpha proteins [46456] (202 folds) |
Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins) |
Protein Class alpha GST [81349] (8 species) |
Species Schistosoma japonicum [TaxId:6182] [47633] (8 PDB entries) |
Domain d1m9ba1: 1m9b A:81-216 [84884] Other proteins in same PDB: d1m9ba2 complexed with ibg |
PDB Entry: 1m9b (more details), 2.6 Å
SCOP Domain Sequences for d1m9ba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m9ba1 a.45.1.1 (A:81-216) Class alpha GST {Schistosoma japonicum} mlggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchk tylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkkrieaipqidkylksskyia wplqgwqatfgggdhp
Timeline for d1m9ba1: