SCOP 1.65: Domain d1m9ba1: 1m9b A:81-216

Lineage for d1m9ba1 (1m9b A:81-216)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (15 proteins)

6. Protein Class alpha GST [81349] (8 species)

7. Species Schistosoma japonicum [TaxId:6182] [47633] (8 PDB entries)

8. Domain d1m9ba1: 1m9b A:81-216 [84884]
   Other proteins in same PDB: d1m9ba2
   complexed with ibg

Details for d1m9ba1

PDB Entry: 1m9b, 2.6 Å

PDB Description: Crystal structure of the 26 kDa glutathione S-transferase from Schistosoma japonicum complexed with gamma-glutamyl[S-(2-iodobenzyl)cysteinyl]glycine

SCOP Domain Sequences for d1m9ba1:

Sequence; same for both SEQRES and ATOM records:

>d1m9ba1 a.45.1.1 (A:81-216) Class alpha GST {Schistosoma japonicum}
mlggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchk
tylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkkrieaipqidkylksskyia
wplqgwqatfgggdhp

Timeline for d1m9ba1:

• d1m9ba1 is new in SCOP 1.65
  
• d1m9ba1 appears in SCOP 1.67
  
• d1m9ba1 appears in the current release, SCOPe 2.08