SCOP 1.67: Domain d1m9ba2: 1m9b A:1-80

Lineage for d1m9ba2 (1m9b A:1-80)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (14 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)

6. Protein Class alpha GST [81360] (8 species)

7. Species Schistosoma japonicum [TaxId:6182] [52878] (8 PDB entries)

8. Domain d1m9ba2: 1m9b A:1-80 [84885]
   Other proteins in same PDB: d1m9ba1
   complexed with ibg

Details for d1m9ba2

PDB Entry: 1m9b, 2.6 Å

PDB Description: Crystal structure of the 26 kDa glutathione S-transferase from Schistosoma japonicum complexed with gamma-glutamyl[S-(2-iodobenzyl)cysteinyl]glycine

SCOP Domain Sequences for d1m9ba2:

Sequence; same for both SEQRES and ATOM records:

>d1m9ba2 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma japonicum}
mspilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyid
gdvkltqsmaiiryiadkhn

Timeline for d1m9ba2:

• d1m9ba2 first appeared in SCOP 1.65
  
• d1m9ba2 appears in SCOP 1.69
  
• d1m9ba2 appears in the current release, SCOPe 2.08