Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) |
Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins) |
Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species) |
Species Yeast (Candida albicans) [TaxId:5476] [53609] (17 PDB entries) |
Domain d1m78a_: 1m78 A: [84855] complexed with clz, ndp |
PDB Entry: 1m78 (more details), 1.71 Å
SCOPe Domain Sequences for d1m78a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m78a_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Yeast (Candida albicans) [TaxId: 5476]} mlkpnvaiivaalkpalgigykgkmpwrlrkeiryfkdvttrttkpntrnavimgrktwe sipqkfrplpdrlniilsrsyeneiiddniihassiesslnlvsdvervfiiggaeiyne linnslvshlliteiehpspesiemdtflkfpleswtkqpkselqkfvgdtvleddikeg dftynytlwtrk
Timeline for d1m78a_: