Lineage for d1m78b_ (1m78 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2510888Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2510889Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2510890Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 2511215Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species)
  7. 2511367Species Yeast (Candida albicans) [TaxId:5476] [53609] (17 PDB entries)
  8. 2511379Domain d1m78b_: 1m78 B: [84856]
    complexed with clz, ndp

Details for d1m78b_

PDB Entry: 1m78 (more details), 1.71 Å

PDB Description: candida albicans dihydrofolate reductase complexed with dihydro- nicotinamide-adenine-dinucleotide phosphate (nadph) and 5-chloryl-2, 4,6-quinazolinetriamine (gw1225)
PDB Compounds: (B:) dihydrofolate reductase

SCOPe Domain Sequences for d1m78b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m78b_ c.71.1.1 (B:) Dihydrofolate reductases, eukaryotic type {Yeast (Candida albicans) [TaxId: 5476]}
mlkpnvaiivaalkpalgigykgkmpwrlrkeiryfkdvttrttkpntrnavimgrktwe
sipqkfrplpdrlniilsrsyeneiiddniihassiesslnlvsdvervfiiggaeiyne
linnslvshlliteiehpspesiemdtflkfpleswtkqpkselqkfvgdtvleddikeg
dftynytlwtrk

SCOPe Domain Coordinates for d1m78b_:

Click to download the PDB-style file with coordinates for d1m78b_.
(The format of our PDB-style files is described here.)

Timeline for d1m78b_: