SCOPe 2.02: Domain d1leia2: 1lei A:19-191

Lineage for d1leia2 (1lei A:19-191)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (7 families)

5. Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (6 proteins)

6. Protein p65 subunit of NF-kappa B (NFKB), N-terminal domain [49428] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [49429] (8 PDB entries)

8. Domain d1leia2: 1lei A:19-191 [84600]
   Other proteins in same PDB: d1leia1, d1leib1, d1leib2
   protein/DNA complex

Details for d1leia2

PDB Entry: 1lei, 2.7 Å

PDB Description: the kb dna sequence from the hlv-ltr functions as an allosteric regulator of hiv transcription

PDB Compounds: (A:) nuclear factor nf-kappa-b p65 subunit

SCOPe Domain Sequences for d1leia2:

Sequence; same for both SEQRES and ATOM records:

>d1leia2 b.2.5.3 (A:19-191) p65 subunit of NF-kappa B (NFKB), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
ayveiieqpkqrgmrfrykcegrsagsipgerstdttkthptikingytgpgtvrislvt
kdpphrphphelvgkdcrdgyyeadlcpdrsihsfqnlgiqcvkkrdleqaisqriqtnn
npfhvpieeqrgdydlnavrlcfqvtvrdpagrpllltpvlshpifdnrapnt

Timeline for d1leia2:

• d1leia2 first appeared in SCOP 1.65
  
• d1leia2 appears in SCOPe 2.01
  
• d1leia2 appears in SCOPe 2.03
  
• d1leia2 appears in the current release, SCOPe 2.08