SCOPe 2.02: Domain d1leib1: 1lei B:251-350

Lineage for d1leib1 (1lei B:251-350)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (7 proteins)
   subgroup of the larger IPT/TIG domain family

6. Protein p50 subunit of NF-kappa B transcription factor [49248] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [49250] (10 PDB entries)

8. Domain d1leib1: 1lei B:251-350 [84601]
   Other proteins in same PDB: d1leia1, d1leia2, d1leib2
   protein/DNA complex

Details for d1leib1

PDB Entry: 1lei, 2.7 Å

PDB Description: the kb dna sequence from the hlv-ltr functions as an allosteric regulator of hiv transcription

PDB Compounds: (B:) nuclear factor nf-kappa-b p50 subunit

SCOPe Domain Sequences for d1leib1:

Sequence; same for both SEQRES and ATOM records:

>d1leib1 b.1.18.1 (B:251-350) p50 subunit of NF-kappa B transcription factor {Mouse (Mus musculus) [TaxId: 10090]}
vrmdrtagcvtggeeiyllcdkvqkddiqirfyeeeenggvwegfgdfsptdvhrqfaiv
fktpkykdvnitkpasvfvqlrrksdletsepkpflyype

Timeline for d1leib1:

• d1leib1 first appeared in SCOP 1.65
  
• d1leib1 appears in SCOPe 2.01
  
• d1leib1 appears in SCOPe 2.03
  
• d1leib1 appears in the current release, SCOPe 2.08