Lineage for d1leia2 (1lei A:20-191)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. Family b.2.5.3: Rel/Dorsal transcription factors, DNA-binding domain [81315] (7 proteins)
    automatically mapped to Pfam PF00554
  6. Protein p65 subunit of NF-kappa B (NFKB), N-terminal domain [49428] (3 species)
  7. Species Mouse (Mus musculus) [TaxId:10090] [49429] (9 PDB entries)
  8. Domain d1leia2: 1lei A:20-191 [84600]
    Other proteins in same PDB: d1leia1, d1leia3, d1leib1, d1leib2
    protein/DNA complex

Details for d1leia2

PDB Entry: 1lei (more details), 2.7 Å

PDB Description: The kB DNA sequence from the HLV-LTR functions as an allosteric regulator of HIV transcription
PDB Compounds: (A:) nuclear factor nf-kappa-b p65 subunit

SCOPe Domain Sequences for d1leia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1leia2 b.2.5.3 (A:20-191) p65 subunit of NF-kappa B (NFKB), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
yveiieqpkqrgmrfrykcegrsagsipgerstdttkthptikingytgpgtvrislvtk
dpphrphphelvgkdcrdgyyeadlcpdrsihsfqnlgiqcvkkrdleqaisqriqtnnn
pfhvpieeqrgdydlnavrlcfqvtvrdpagrpllltpvlshpifdnrapnt

SCOPe Domain Coordinates for d1leia2 are not available.

Timeline for d1leia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1leia1, d1leia3
View in 3D
Domains from other chains:
(mouse over for more information)
d1leib1, d1leib2