Lineage for d1l3pa_ (1l3p A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988268Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1989186Superfamily a.24.17: Group V grass pollen allergen [81736] (1 family) (S)
  5. 1989187Family a.24.17.1: Group V grass pollen allergen [81737] (2 proteins)
  6. 1989188Protein Functional domain of pollen allergen Phl P 5b [89020] (1 species)
  7. 1989189Species Timothy grass (Phleum pratense) [TaxId:15957] [89021] (1 PDB entry)
  8. 1989190Domain d1l3pa_: 1l3p A: [84520]
    complexed with mg, po4

Details for d1l3pa_

PDB Entry: 1l3p (more details), 1.98 Å

PDB Description: crystal structure of the functional domain of the major grass pollen allergen phl p 5b
PDB Compounds: (A:) POLLEN ALLERGEN Phl p 5b

SCOPe Domain Sequences for d1l3pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l3pa_ a.24.17.1 (A:) Functional domain of pollen allergen Phl P 5b {Timothy grass (Phleum pratense) [TaxId: 15957]}
ipagelqiidkidaafkvaataaatapaddkftvfeaafnkaikettggaydtykcipsl
eaavkqayaatvaaapqvkyavfeaaltkaitamsevqkvsq

SCOPe Domain Coordinates for d1l3pa_:

Click to download the PDB-style file with coordinates for d1l3pa_.
(The format of our PDB-style files is described here.)

Timeline for d1l3pa_: