SCOPe 2.08: Domain d1l3pa_: 1l3p A:

Lineage for d1l3pa_ (1l3p A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.17: Group V grass pollen allergen [81736] (1 family)

5. Family a.24.17.1: Group V grass pollen allergen [81737] (2 proteins)

6. Protein Functional domain of pollen allergen Phl P 5b [89020] (1 species)

7. Species Timothy grass (Phleum pratense) [TaxId:15957] [89021] (1 PDB entry)

8. Domain d1l3pa_: 1l3p A: [84520]
   complexed with mg, po4

Details for d1l3pa_

PDB Entry: 1l3p, 1.98 Å

PDB Description: crystal structure of the functional domain of the major grass pollen allergen phl p 5b

PDB Compounds: (A:) POLLEN ALLERGEN Phl p 5b

SCOPe Domain Sequences for d1l3pa_:

Sequence; same for both SEQRES and ATOM records:

>d1l3pa_ a.24.17.1 (A:) Functional domain of pollen allergen Phl P 5b {Timothy grass (Phleum pratense) [TaxId: 15957]}
ipagelqiidkidaafkvaataaatapaddkftvfeaafnkaikettggaydtykcipsl
eaavkqayaatvaaapqvkyavfeaaltkaitamsevqkvsq

Timeline for d1l3pa_:

• d1l3pa_ first appeared in SCOP 1.65
  
• d1l3pa_ appears in SCOPe 2.07